DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Ssrp1

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_038961847.1 Gene:Ssrp1 / 81785 RGDID:621143 Length:805 Species:Rattus norvegicus


Alignment Length:239 Identity:56/239 - (23%)
Similarity:97/239 - (40%) Gaps:49/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DAVPESPVSLPIASQSMDTATIEDFD----------------EDKPAKGKKKAKNPKGRHSDSDI 58
            |:..|:..|.....:..|.|  |:||                |:|..|..|:||..|.|.|... 
  Rat   569 DSGEETDESFNPGEEEEDVA--EEFDSNASASSSSNEGDSDREEKKRKQLKRAKMAKDRKSRKK- 630

  Fly    59 GSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKL 123
            .||.||...     ..|||.|::.|:.::|..||:::.:.|..:..:.::..||.|..:.:|:|.
  Rat   631 SSEGKKGKD-----PNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKE 690

  Fly   124 PYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAK----- 183
            .:...|...:..|::.::.:.....:....:.:|.||..|.....|....:|.|:...::     
  Rat   691 EWDRKAEDARREYEKAMKEYEGGRGDSSKRDKSKKKKKVKAKLEKKSTPSRGSSSKSSSRQLSDS 755

  Fly   184 ---------------KTKAKPVKRQSEDPDDVPLAKVKRAQTPP 212
                           :.|:|..:|:|||.|:..|     |.|||
  Rat   756 FKSKEFVSSDESSSGENKSKKKRRRSEDSDEEEL-----ASTPP 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 15/64 (23%)
Ssrp1XP_038961847.1 POB3 114..576 CDD:227494 2/6 (33%)
HMG_box 643..710 CDD:395407 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.