DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and TFAM

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_003192.1 Gene:TFAM / 7019 HGNCID:11741 Length:246 Species:Homo sapiens


Alignment Length:142 Identity:39/142 - (27%)
Similarity:70/142 - (49%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIY 136
            :|..||.|::.|:||..::....:.:.|.....|..|.|.:.|.:||:.:|..|.:|...:..:|
Human    46 LASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVY 110

  Fly   137 QEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEK--TPKGE-SALGKAKKTKAK----PVKRQS 194
            :|::..| ||  ::..:::...:|.. :|...|.|  |.|.| :.|||.|:.::.    ..:|..
Human   111 KEEISRF-KE--QLTPSQIMSLEKEI-MDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQ 171

  Fly   195 EDPDDVPLAKVK 206
            |...|.|..|:|
Human   172 EAKGDSPQEKLK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
TFAMNP_003192.1 HMG_box 50..117 CDD:395407 18/66 (27%)
HMGB-UBF_HMG-box 155..216 CDD:238686 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.