DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Hmgb4

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_081312.2 Gene:Hmgb4 / 69317 MGIID:1916567 Length:181 Species:Mus musculus


Alignment Length:206 Identity:46/206 - (22%)
Similarity:77/206 - (37%) Gaps:41/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PKMPLNGYVRFMNDRREELRREQPQRTAL---EHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQ 137
            ||:.::.|:.||.:.|.:.:.:|| .|.|   |.:|...|:|..:.:..|..|...|..|||.||
Mouse     9 PKVNVSSYIHFMLNFRNKFKEQQP-NTYLGFKEFSRKCSEKWRSISKHEKAKYEALAELDKARYQ 72

  Fly   138 EQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDVPL 202
            :::.           |.:.|.:|..|.|.....|.|.......:......|     .|:| |..:
Mouse    73 QEMM-----------NYIGKRRKRRKRDPKAPRKPPSSFLLFSRDHYAMLK-----QENP-DWTV 120

  Fly   203 AKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRPLQPGEIPIYTNEFIEHNRSTENELR----- 262
            .:|.:|......|...|..:|               ...:..:...::.|...:..|:.:     
Mouse   121 VQVAKAAGKMWSTTDEAEKKP---------------YEQKAALMRAKYFEEQEAYRNQCQGRKGN 170

  Fly   263 TLRKAKTDLEQ 273
            .|..|||.|:|
Mouse   171 FLESAKTSLKQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 22/67 (33%)
Hmgb4NP_081312.2 HMG-box 8..78 CDD:294061 22/80 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..100 6/19 (32%)
HMG-box 93..156 CDD:238037 11/83 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.