Sequence 1: | NP_611553.1 | Gene: | Hmg-2 / 37407 | FlyBaseID: | FBgn0026582 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081312.2 | Gene: | Hmgb4 / 69317 | MGIID: | 1916567 | Length: | 181 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 46/206 - (22%) |
---|---|---|---|
Similarity: | 77/206 - (37%) | Gaps: | 41/206 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 PKMPLNGYVRFMNDRREELRREQPQRTAL---EHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQ 137
Fly 138 EQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDVPL 202
Fly 203 AKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRPLQPGEIPIYTNEFIEHNRSTENELR----- 262
Fly 263 TLRKAKTDLEQ 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hmg-2 | NP_611553.1 | HMGB-UBF_HMG-box | 76..141 | CDD:238686 | 22/67 (33%) |
Hmgb4 | NP_081312.2 | HMG-box | 8..78 | CDD:294061 | 22/80 (28%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 80..100 | 6/19 (32%) | |||
HMG-box | 93..156 | CDD:238037 | 11/83 (13%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |