DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and UBTFL1

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001137447.1 Gene:UBTFL1 / 642623 HGNCID:14533 Length:393 Species:Homo sapiens


Alignment Length:256 Identity:63/256 - (24%)
Similarity:104/256 - (40%) Gaps:59/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LKKL--AQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLP 124
            :||:  :|:..|....||.||..|.||..:...:..:..|...:.|.|:|:.:::.:|||:.|..
Human    84 VKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPGMRSQELTKILSKKYRELPEQMKQK 148

  Fly   125 YIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKA-K 188
            ||:...|:|..::|:|..|.:|||::|    .||||                |::.|..:.|. |
Human   149 YIQDFRKEKQEFEEKLARFREEHPDLV----QKAKK----------------SSVSKRTQNKVQK 193

  Fly   189 PVKRQSEDPDDVP-----LAKVKRAQTPPPPTPPAAPVQPPP--------------SSVPPATPA 234
            ..::..|:...:|     ..|||....|          |.||              ..:...:..
Human   194 KFQKNIEEVRSLPKTDRFFKKVKFHGEP----------QKPPMNGYHKFHQDSWSSKEMQHLSVR 248

  Fly   235 PRPLQPG----EIPIYTNEFIEHNRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYAK 291
            .|.::.|    .||   ....:|.:|...||:...|.|.||..:....|.:....::.|||
Human   249 ERMVEIGRRWQRIP---QSQKDHFKSQAEELQKQYKVKLDLWLKTLSPENYAAYKESTYAK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 20/64 (31%)
UBTFL1NP_001137447.1 HMGB-UBF_HMG-box 100..165 CDD:238686 20/64 (31%)
HMGB-UBF_HMG-box 223..285 CDD:238686 12/64 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.