DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and hmgb2a

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001032501.1 Gene:hmgb2a / 641484 ZFINID:ZDB-GENE-051120-126 Length:213 Species:Danio rerio


Alignment Length:169 Identity:40/169 - (23%)
Similarity:66/169 - (39%) Gaps:43/169 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IEDFDEDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELR 95
            ::::...|.|||.||.|:|                        .|||.|.:.:..|.:|.|.:::
Zfish    74 MKNYVPPKGAKGGKKKKDP------------------------NAPKRPPSAFFVFCSDHRPKVK 114

  Fly    96 REQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKK 160
            .:.|..:..:..:.:||.|.:|..:.|.||.:.|.|.|..|::.:              .|...|
Zfish   115 GDNPGISIGDIAKKLGEMWSKLSPKEKSPYEQKAMKLKEKYEKDV--------------AAYRAK 165

  Fly   161 ATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDD 199
            ..|.||:     .||.......||.:|.....:.||.:|
Zfish   166 GVKPDGA-----KKGGPGRPAGKKAEADDDDDEDEDEED 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
hmgb2aNP_001032501.1 HMG_box_2 6..77 CDD:286146 0/2 (0%)
HMG_box 95..162 CDD:278906 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.