DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and tfam

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001070857.1 Gene:tfam / 571106 ZFINID:ZDB-GENE-061013-552 Length:277 Species:Danio rerio


Alignment Length:306 Identity:67/306 - (21%)
Similarity:119/306 - (38%) Gaps:87/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQE 138
            |.||.||..|:.|:.|.:..:.::.|...:::..|.|.::|..|..|:|.|:..|:.:.|..|:.
Zfish    45 GPPKRPLTAYMTFVKDMQPTVSKQNPSIKSVDVMRKIAQQWKMLTTEQKQPFQVASLEAKEQYKL 109

  Fly   139 QLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKK---TKAKPVKRQSEDPDDV 200
            .|:.|                ||        :.||...:|..:.|:   .|.|.::::.|..:  
Zfish   110 ALEKF----------------KA--------QLTPAESAAFAEEKRQRVAKRKAIRKKKELNN-- 148

  Fly   201 PLAKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRPLQPGEIPIYTNE-FIE-HNRSTENELRT 263
             |.|.||                           ||    ....|:..| |:| ...:|:.:|::
Zfish   149 -LGKPKR---------------------------PR----STFNIFMAEHFVEAKGTTTQAKLKS 181

  Fly   264 LR---KAKTDLEQQNAVLEQHVDNTKAGYAKVMGEVTELMEENQRLETYLRALRQKLVAALGGIS 325
            ||   ...:|.::|..:  |..::.|..|...:....|.|.|..|.:    .||:|..:||    
Zfish   182 LRDDWNRLSDTQKQMYI--QLAEDDKVRYKNEIKSWEEHMMEIGRED----LLRRKTKSAL---- 236

  Fly   326 MPPLEPSGPSVGNIDKYIRHLAGLVTQPSNVTLIKAREALRKVDTS 371
              ..:....::...::         .:.|.||:|||:...:|.|.|
Zfish   237 --KAKAKTKTIATKNR---------KKTSKVTVIKAKAPKKKKDAS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
tfamNP_001070857.1 HMG_box 47..114 CDD:278906 19/66 (29%)
HMGB-UBF_HMG-box 152..213 CDD:238686 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.