DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and tox

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001243623.1 Gene:tox / 569666 ZFINID:ZDB-GENE-070912-181 Length:540 Species:Danio rerio


Alignment Length:369 Identity:73/369 - (19%)
Similarity:118/369 - (31%) Gaps:130/369 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PESPVSLPIASQSMDTATIEDFDEDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPK 77
            |||..:.|..|.|     :.:.|.|..||     .|...:.:.:|:..:.|...:::......|:
Zfish   236 PESKSATPSPSSS-----VHEDDADDAAK-----INGAEKRAATDMAKKPKTPKKKKKKDPNEPQ 290

  Fly    78 MPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQM 142
            .|::.|..|..|.:..::.:.|..|..|.::|:...|..|.||:|..|.:.....|..|.:||..
Zfish   291 KPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTETAKKEYLKQLAA 355

  Fly   143 FLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDVPLAKVKR 207
            :                                          :|..|.:...||.||..::..:
Zfish   356 Y------------------------------------------RASLVSQSYNDPGDVKASQASQ 378

  Fly   208 AQTPPPP-------TPPAAPVQPP-------PSSVPPATP---------------------APRP 237
            ...|.||       |.|...:.||       .|.:||..|                     :|.|
Zfish   379 MLGPKPPVFSGAGQTHPGLYMAPPYHQQPGLSSHLPPMQPGLSRGGASRPGAVSMSSMTGSSPPP 443

  Fly   238 LQPGEIPIYTNEFIEHNRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYAKVMGEVTELMEE 302
            ||... |::.:..:.|                  :||...:..|   |.|.::..|.:...|..|
Zfish   444 LQISP-PLHQHLSLHH------------------QQQQQQIGSH---TLALHSPSMAQGFPLQAE 486

  Fly   303 NQRLETYLRALRQKLVAALGGISMPPLEPS---------GPSVG 337
            .|.:..         |.:..|   |.|.||         ||:.|
Zfish   487 YQSMVN---------VTSSAG---PGLSPSMDYRTGCRNGPTQG 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
toxNP_001243623.1 HMG-box 289..>338 CDD:238037 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.