DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and ssrp1b

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021332622.1 Gene:ssrp1b / 449949 ZFINID:ZDB-GENE-041008-209 Length:705 Species:Danio rerio


Alignment Length:216 Identity:54/216 - (25%)
Similarity:89/216 - (41%) Gaps:43/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASQSMDTATIEDFDEDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRF 86
            ||.|..:|...|.|||:..|..||.|..|.|       ...||  ::::..:||||.|::.|:.:
Zfish   500 ASASESSAEEGDSDEDRKKKSAKKVKFVKER-------KPRKK--EKKVKDSGAPKRPMSAYMLW 555

  Fly    87 MNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIV 151
            :|..|:.::.|.|..:..|.::..||.|.||.:::|..:...|.:.|..|...    ::|:.|..
Zfish   556 LNSSRDRIKSENPGISITEISKKAGEMWKQLGKDKKEEWDGKAEEAKKEYDRA----MREYRESG 616

  Fly   152 ANELAKAKKATKLDGSPKEKTPKGESALGKAKK-------------------------TKAKPVK 191
            ......:||..|......|:..|.:|..|:.|:                         .|.|..|
Zfish   617 GGSSGSSKKERKKKRGRNEEKRKRKSGAGREKEKERSTGNDSFKSREFISSEESSSESDKGKKRK 681

  Fly   192 RQSEDPDDVPLAKVKRAQTPP 212
            |:..|.:     |.:.|.:.|
Zfish   682 RKGSDNE-----KEEEAVSTP 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
ssrp1bXP_021332622.1 POB3 21..516 CDD:227494 7/15 (47%)
SSrecog 75..285 CDD:308895
HMG_box 545..612 CDD:278906 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.