DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and hmgb3

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001004888.1 Gene:hmgb3 / 448228 XenbaseID:XB-GENE-1002014 Length:202 Species:Xenopus tropicalis


Alignment Length:212 Identity:50/212 - (23%)
Similarity:75/212 - (35%) Gaps:81/212 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PESPVSLPIAS-------QSMDTATIEDFDE----DK-----------PAKGKKKAKNPKGRHSD 55
            ||.||:....|       ::|.......||:    ||           |.|..||.|:|      
 Frog    32 PEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVKKGKKKKDP------ 90

  Fly    56 SDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEE 120
                              .|||.|.:|:..|.::.|.:::...|..:..:..:.:||.|:.|.:.
 Frog    91 ------------------NAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDG 137

  Fly   121 RKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLD---GSPKEKTPKGESALGKA 182
            .|.||...|||.|..|::               ::|..|...|.|   |:||           .|
 Frog   138 EKQPYNNKAAKLKEKYEK---------------DVADYKSKGKFDCAKGAPK-----------LA 176

  Fly   183 KKTKAKPVKRQSEDPDD 199
            :|      |.:.||.||
 Frog   177 RK------KEEDEDDDD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 19/64 (30%)
hmgb3NP_001004888.1 HMG-box 13..78 CDD:381793 10/45 (22%)
HMG_box 93..160 CDD:366139 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.