DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and tHMG2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:123 Identity:34/123 - (27%)
Similarity:60/123 - (48%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PKMPLNGYVRFMNDR-REELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQ 139
            ||.|::.::.:||.. |:.:|.|.|..:..|.:...||.|..:.:|.|:.:.|:|:|..|.|:|:
  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73

  Fly   140 LQMF--LKEH-----PEI----VANELAKAKKATKL---DGSPKEKTPKGESALGKAK 183
            |:.:  .|||     |.|    :::..:|..:...|   |...:...|...:...|||
  Fly    74 LEKWNAFKEHQTESFPHIYEAPLSSRFSKTNQRPTLFVYDSKDEAMAPICRTCFSKAK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 21/65 (32%)
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.