DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and hmgb1

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_989226.1 Gene:hmgb1 / 394834 XenbaseID:XB-GENE-1001206 Length:211 Species:Xenopus tropicalis


Alignment Length:163 Identity:45/163 - (27%)
Similarity:63/163 - (38%) Gaps:51/163 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PAKG--KKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQR 101
            |.||  |||.|:|                        .|||.|.:.:..|.::.|.:::.|.|..
 Frog    80 PPKGETKKKFKDP------------------------NAPKRPPSAFFLFCSEFRPKIKGEHPGS 120

  Fly   102 TALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDG 166
            |..:..:.:||.|:....:.||||...|||.|..|::.           ||...||.|.      
 Frog   121 TIGDIAKKLGEMWNNTATDDKLPYERKAAKLKEKYEKD-----------VAAYRAKGKP------ 168

  Fly   167 SPKEKTPKGESALGKAKKTKAKPVKRQSEDPDD 199
            .|.:|.|        ||..|||..:...:|.||
 Frog   169 EPAKKAP--------AKFEKAKKKEDDDDDEDD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 20/64 (31%)
hmgb1NP_989226.1 HMG_box_2 6..78 CDD:370242
HMG_box 95..162 CDD:366139 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.