DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and hmgb2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_988904.1 Gene:hmgb2 / 394499 XenbaseID:XB-GENE-1000246 Length:212 Species:Xenopus tropicalis


Alignment Length:216 Identity:52/216 - (24%)
Similarity:78/216 - (36%) Gaps:82/216 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PESPVSLPIAS-------QSMDTATIEDFDE----DK-----------PAKGKKKAKNPKGRHSD 55
            |:|.|:....|       ::|.......|:|    ||           |.||:||.|..|.    
 Frog    32 PDSSVNFAEFSKKCSERWKTMSAKEKSKFEEMAKNDKVRYEREMKTYIPPKGEKKGKKKKD---- 92

  Fly    56 SDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEE 120
                             ..|||.|.:.:..|.::.|.:::.|.|..:..:..:.:||.|.:...:
 Frog    93 -----------------PNAPKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPK 140

  Fly   121 RKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGK---- 181
            .||||.:.|||.|..|::.:                .|.||            ||:|.:||    
 Frog   141 DKLPYEQKAAKLKEKYEKDV----------------AAYKA------------KGKSDVGKKVPG 177

  Fly   182 ---AKKTKAKPVKRQSEDPDD 199
               ..|.||:|    .||.||
 Frog   178 RPTGSKKKAEP----EEDDDD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 19/64 (30%)
hmgb2NP_988904.1 HMG_box_2 6..78 CDD:370242 9/45 (20%)
HMG_box 96..163 CDD:366139 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.