Sequence 1: | NP_611553.1 | Gene: | Hmg-2 / 37407 | FlyBaseID: | FBgn0026582 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997967.2 | Gene: | ssrp1a / 386844 | ZFINID: | ZDB-GENE-031118-9 | Length: | 705 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 55/206 - (26%) |
---|---|---|---|
Similarity: | 94/206 - (45%) | Gaps: | 23/206 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 DAVPESPVSLPIASQSMDTATIEDFDEDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAG 74
Fly 75 APKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQ 139
Fly 140 LQMFLKEHPEIVANELAKAKK-----ATKLDGSPKEKTPKGESALGKAKK-----------TKAK 188
Fly 189 PVKRQSEDPDD 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hmg-2 | NP_611553.1 | HMGB-UBF_HMG-box | 76..141 | CDD:238686 | 19/64 (30%) |
ssrp1a | NP_997967.2 | POB3 | 21..512 | CDD:227494 | 8/28 (29%) |
SSrecog | 75..285 | CDD:281523 | |||
PH2_SSRP1-like | 333..428 | CDD:270051 | |||
HMG_box | 546..613 | CDD:278906 | 19/66 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573409 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |