DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and ssrp1a

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_997967.2 Gene:ssrp1a / 386844 ZFINID:ZDB-GENE-031118-9 Length:705 Species:Danio rerio


Alignment Length:206 Identity:55/206 - (26%)
Similarity:94/206 - (45%) Gaps:23/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DAVPESPVSLPIASQSMDTATIEDFDEDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAG 74
            |.|||...|    :.|:..:..:|.|.:...|.||..|.||....:.   .|.|...::::..|.
Zfish   487 DDVPEEYDS----NASVSDSEGDDGDSEDEGKKKKVEKKPKKVVKEK---KERKPRKEKKVKDAA 544

  Fly    75 APKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQ 139
            |||.|::.|:.::|..||.::.|.|..:..|.::..||.|.||.:::|..:.:.|.:.|..|::.
Zfish   545 APKRPMSAYMLWLNGNRERIKSENPGISITEISKKAGEMWKQLGKDKKEEWDKKAEEAKRQYEKA 609

  Fly   140 LQMFLKEHPEIVANELAKAKK-----ATKLDGSPKEKTPKGESALGKAKK-----------TKAK 188
            ::.:.:......|....|.||     |.|..|..|||..:|.:...|:|:           ...:
Zfish   610 MKEYKESGGGAAAATKEKKKKGGKVEAKKKSGGEKEKKKEGGNDSFKSKEFISSEESSSESDHDR 674

  Fly   189 PVKRQSEDPDD 199
            ..||::.|.||
Zfish   675 GSKRKASDDDD 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 19/64 (30%)
ssrp1aNP_997967.2 POB3 21..512 CDD:227494 8/28 (29%)
SSrecog 75..285 CDD:281523
PH2_SSRP1-like 333..428 CDD:270051
HMG_box 546..613 CDD:278906 19/66 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.