DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and CG12104

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster


Alignment Length:210 Identity:50/210 - (23%)
Similarity:82/210 - (39%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPDAVPESPVSLPIASQSMDTATIEDFDE---DKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRR 69
            || |..:||........|:|.:.:.|.||   |..|.|.               |..|....:::
  Fly    19 TP-AESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGG---------------GQNLLVQPEQQ 67

  Fly    70 IN--VAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEE-WHQLPEERKLPYIEAAAK 131
            .|  :|.||..||..:..|..|....::::.| ..:||..::|.:. |..|.|.:|..|.....:
  Fly    68 QNQAMAQAPPKPLAPFALFFRDTVTAIKQQNP-TCSLEQMQVIVQTMWESLDETQKNVYALRHEQ 131

  Fly   132 DKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSED 196
            :|..|...::.:..:..|......|:|..|...:..|...|.|.||.....:...|    :|...
  Fly   132 EKREYVRLMRGYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKLESVEDLQQSVDA----QQEPP 192

  Fly   197 PDDVPL----AKVKR 207
            ||.:.|    |:|::
  Fly   193 PDQIQLLTEAARVQK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 16/65 (25%)
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.