DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Ssrp

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster


Alignment Length:224 Identity:58/224 - (25%)
Similarity:102/224 - (45%) Gaps:43/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SQSMDTATIEDFDEDKPAKG----------KKKAKNPK-----GRHSDSDIGSELKKLAQRRINV 72
            ::..|:....|.|:|..|.|          ||:.|:.|     .:|.:.:   ..||.::::.: 
  Fly   491 AEEYDSNVESDSDDDSDASGGGGDSDGAKKKKEKKSEKKEKKEKKHKEKE---RTKKPSKKKKD- 551

  Fly    73 AGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQ 137
            :|.||.....::.::||.||.::||.|.....|..:..||.|.:|.::.|  :.:||||||..|.
  Fly   552 SGKPKRATTAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKELKDKSK--WEDAAAKDKQRYH 614

  Fly   138 EQLQMFLKEHPEIVANEL-AKAKKATKLDGSPKEKTPKGESALGKAKKTKA-------------- 187
            ::::.:..|......||. .|:.|..|.:.||.:|.    :..|...|:|.              
  Fly   615 DEMRNYKPEAGGDSDNEKGGKSSKKRKTEPSPSKKA----NTSGSGFKSKEYISDDDSTSSDDEK 675

  Fly   188 --KPVKRQSEDPDDVPLAKVKRAQTPPPP 214
              :|.|::|:.|.|.. ||.|:|::...|
  Fly   676 DNEPAKKKSKPPSDGD-AKKKKAKSESEP 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 22/64 (34%)
SsrpNP_523830.2 POB3 20..499 CDD:227494 1/7 (14%)
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 20/64 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450772
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.