DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Sox15

DIOPT Version :10

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:124 Identity:26/124 - (20%)
Similarity:50/124 - (40%) Gaps:15/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 IIFGVIHMLFGVFVGLFNHRYFKNKMAIYCEFIPQVIFLVFLFFYMTLLMFIKWVKYSASATDVV 606
            ::.|...||:|:.:.:|...:..........|.|.:|....|:....:..::::|.|....|   
  Fly   628 MLLGFAGMLYGLLISIFCDAHSTANFMATGSFYPMIILCGILWPLEGMPQYLQYVAYCFPFT--- 689

  Fly   607 YSEGCAPSILITFINMVLFKAPDEHTGDCSPYMFAGQSGLQKFLVVVALLCVPWMLLAK 665
                 .|||.   :..||.|.  ....:...||..|..|:  :::.:.|||:..:.:.|
  Fly   690 -----IPSIA---VRNVLTKG--WSITNSQVYMGYGAVGV--WIISLLLLCLLGLKIKK 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMG-box_HMG20 75..154 CDD:438796
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841
PHA03273 305..>391 CDD:223031
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.