DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and hmg20a

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001082803.1 Gene:hmg20a / 326908 ZFINID:ZDB-GENE-030131-5107 Length:291 Species:Danio rerio


Alignment Length:345 Identity:96/345 - (27%)
Similarity:157/345 - (45%) Gaps:86/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDKP-----AKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELR 95
            ::||     .||:::.|..|    ||:                 |||.||.|||||||:|||:||
Zfish    21 DEKPRRSSWTKGRRRKKPLK----DSN-----------------APKAPLTGYVRFMNERREQLR 64

  Fly    96 REQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLK-EHPEIVANELAKAK 159
            .|:|.....|.||::|.||.:||.:.|..|::.|.|||..|..:|:.:.| |..:..:.::.:.:
Zfish    65 AERPDVPFPEITRMLGNEWSKLPADEKQRYLDEADKDKERYMRELEQYQKTEAYKHFSRKVQEKQ 129

  Fly   160 KATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDVPLAKVKRAQTPPPPTPPAAPVQPP 224
            |..:..|....:.| |||...|..:||.:.|                                  
Zfish   130 KGKRHRGDAGRQAP-GESLHEKDLETKDRSV---------------------------------- 159

  Fly   225 PSSVPPATPAPRPLQPGEIPIYTNEFIEHNRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGY 289
                            .:|||:|.||:.|:::.|.|:|.|||...:.|::||.|::||::.::..
Zfish   160 ----------------FDIPIFTEEFLNHSKAREAEMRQLRKTNMEYEERNAALQKHVESMRSAV 208

  Fly   290 AKVMGEVTELMEENQRLETYLRALRQKLVAALGGISMPPLEPSG--PSVGNIDKYIRHLAGLV-- 350
            .::.|:|.:....|..|..:|..||..|..:   .|..||..||  |::.:||.|::.|..|:  
Zfish   209 ERLEGDVLQERTRNSLLLQHLETLRSALTHS---FSTVPLPGSGETPTLESIDSYMKKLHSLILS 270

  Fly   351 -TQPSNVTLIKAREALRKVD 369
             .|.....:...|:.:.::|
Zfish   271 SPQDHQHLISTVRDVVNRLD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 33/64 (52%)
hmg20aNP_001082803.1 HMGB-UBF_HMG-box 45..110 CDD:238686 33/64 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8289
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32399
Inparanoid 1 1.050 126 1.000 Inparanoid score I4669
OMA 1 1.010 - - QHG45555
OrthoDB 1 1.010 - - D1458939at2759
OrthoFinder 1 1.000 - - FOG0003510
OrthoInspector 1 1.000 - - otm25636
orthoMCL 1 0.900 - - OOG6_106551
Panther 1 1.100 - - O PTHR46040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X2882
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.