Sequence 1: | NP_611553.1 | Gene: | Hmg-2 / 37407 | FlyBaseID: | FBgn0026582 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955849.2 | Gene: | hmgb1a / 321622 | ZFINID: | ZDB-GENE-030131-341 | Length: | 205 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 79/200 - (39%) | Gaps: | 55/200 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 PESPVSLPIASQ----------SMDTATIEDFDEDKPAKGKKKAKN---PKGRHSDSDIGSELKK 64
Fly 65 LAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAA 129
Fly 130 AKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQS 194
Fly 195 EDPDD 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hmg-2 | NP_611553.1 | HMGB-UBF_HMG-box | 76..141 | CDD:238686 | 19/64 (30%) |
hmgb1a | NP_955849.2 | HMG-box | 7..77 | CDD:320749 | 8/45 (18%) |
HMG_box | 94..161 | CDD:278906 | 19/66 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3288 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |