DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and hmgb1a

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_955849.2 Gene:hmgb1a / 321622 ZFINID:ZDB-GENE-030131-341 Length:205 Species:Danio rerio


Alignment Length:200 Identity:48/200 - (24%)
Similarity:79/200 - (39%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PESPVSLPIASQ----------SMDTATIEDFDEDKPAKGKKKAKN---PKGRHSDSDIGSELKK 64
            ||:.|:....|:          :.:....||..:...|:.:::.||   |||         |.||
Zfish    31 PEATVNFSEFSKKCSERWKTMSAKEKGKFEDMAKLDKARYEREMKNYIPPKG---------EKKK 86

  Fly    65 LAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAA 129
                |.....|||.|.:.:..|.::.|.:::.|.|..:..:..:.:||.|:::..|.|.||.:.|
Zfish    87 ----RFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLSIGDVAKRLGEMWNKISSEEKQPYEKKA 147

  Fly   130 AKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQS 194
            ||.|..|::.:..:                            ..||:.. |.|.|..:||.|...
Zfish   148 AKLKEKYEKDIAAY----------------------------RSKGKVG-GGAAKAPSKPDKAND 183

  Fly   195 EDPDD 199
            ||.||
Zfish   184 EDEDD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 19/64 (30%)
hmgb1aNP_955849.2 HMG-box 7..77 CDD:320749 8/45 (18%)
HMG_box 94..161 CDD:278906 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.