DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and HMGB3

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001288160.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:220 Species:Homo sapiens


Alignment Length:209 Identity:50/209 - (23%)
Similarity:82/209 - (39%) Gaps:68/209 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PESPVSLPIAS-------QSMDTATIEDFDE----DK-----------PAKGKKKAKNPKGRHSD 55
            ||.||:....|       ::|.......|||    ||           ||||.||.|:|      
Human    52 PEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDP------ 110

  Fly    56 SDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEE 120
                              .|||.|.:|:..|.::.|.:::...|..:..:..:.:||.|:.|.:.
Human   111 ------------------NAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDS 157

  Fly   121 RKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKT 185
            .|.|||..|||.|..|::               ::|..|...|.||:      ||.:.:.: ||.
Human   158 EKQPYITKAAKLKEKYEK---------------DVADYKSKGKFDGA------KGPAKVAR-KKV 200

  Fly   186 KAKPVKRQSEDPDD 199
            :.:..:.:.|:.::
Human   201 EEEDEEEEEEEEEE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 20/64 (31%)
HMGB3NP_001288160.1 HMG_box_2 33..98 CDD:370242 11/45 (24%)
HMG_box 113..180 CDD:366139 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.