DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and HMGB2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001124160.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:200 Identity:43/200 - (21%)
Similarity:82/200 - (41%) Gaps:45/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PESPVSLPIASQ----------SMDTATIEDFDEDKPAKGKKKAKN---PKGRHSDSDIGSELKK 64
            |:|.|:....|:          :.:.:..||..:...|:..::.||   |||.          ||
Human    32 PDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGD----------KK 86

  Fly    65 LAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAA 129
            ..::..|   |||.|.:.:..|.::.|.:::.|.|..:..:..:.:||.|.:...:.|.||.:.|
Human    87 GKKKDPN---APKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKA 148

  Fly   130 AKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQS 194
            ||.|..|::.:..:..:         .|::...|..|.|          .|..||.:.:..:.:.
Human   149 AKLKEKYEKDIAAYRAK---------GKSEAGKKGPGRP----------TGSKKKNEPEDEEEEE 194

  Fly   195 EDPDD 199
            |:.|:
Human   195 EEEDE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
HMGB2NP_001124160.1 HMG_box_2 6..78 CDD:401091 8/45 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 26/110 (24%)
HMG_box 95..162 CDD:395407 18/66 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 9/56 (16%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 4/33 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.