DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Hmgb2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_058883.1 Gene:Hmgb2 / 29395 RGDID:69291 Length:210 Species:Rattus norvegicus


Alignment Length:200 Identity:44/200 - (22%)
Similarity:82/200 - (41%) Gaps:45/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PESPVSLPIASQ----------SMDTATIEDFDEDKPAKGKKKAKN---PKGRHSDSDIGSELKK 64
            |:|.|:....|:          :.:.:..||..:...|:..::.||   |||.          ||
  Rat    32 PDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGD----------KK 86

  Fly    65 LAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAA 129
            ..::..|   |||.|.:.:..|.::.|.:::.|.|..:..:..:.:||.|.:...:.|.||.:.|
  Rat    87 GKKKDPN---APKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKA 148

  Fly   130 AKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQS 194
            ||.|..|::.:..:..:         .|::...|..|.|          .|..||.:.:..:.:.
  Rat   149 AKLKEKYEKDIAAYRAK---------GKSEVGKKGPGRP----------TGSKKKNEPEDEEEEE 194

  Fly   195 EDPDD 199
            |:.||
  Rat   195 EEEDD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
Hmgb2NP_058883.1 HMG_box_2 6..78 CDD:401091 8/45 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..102 15/63 (24%)
HMG_box 95..162 CDD:395407 18/66 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..210 9/56 (16%)
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 165..180 4/33 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.