DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Tox2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001359507.1 Gene:Tox2 / 269389 MGIID:3611233 Length:541 Species:Mus musculus


Alignment Length:279 Identity:68/279 - (24%)
Similarity:102/279 - (36%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SPVSLPIASQSMDTATIED--------FDEDKPAKGK-KKAKNPKGRHSDSDIGSELKKLAQRRI 70
            ||.....|:.|..::|.|:        ..|.:|:... |||||||                :::.
Mouse   218 SPPGSKSATPSPSSSTQEEESDAHFKISGEKRPSVDPGKKAKNPK----------------KKKK 266

  Fly    71 NVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPY---IEAAAKD 132
            .....|:.|::.|..|..|.:..::.:.|..|..:.::|:...|..|.||:|..|   .|||.|:
Mouse   267 KDPNEPQKPVSAYALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKE 331

  Fly   133 --KAIYQEQLQMFLKEHPE------IVANELAKAKK-----------ATKLDGSPKEKTPKGESA 178
              ||:...:..:..|..|:      ..||..||...           |:.|..|..:....|.|.
Mouse   332 YLKALAAYRASLVSKSPPDQGEAKNTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASP 396

  Fly   179 LGKAKKTKAK---PVKRQSEDPDDVPLAKVKRAQTPPPPTPPAAPVQPP----PSSVPPATPA-- 234
            ...|:...:|   |....|..|...||:.....|.|.||......:.||    |:..||..||  
Mouse   397 ASLARTLGSKALLPGLSTSPPPPSFPLSPSLHQQLPLPPHAQGTLLSPPLSMSPAPQPPVLPASM 461

  Fly   235 ---------PRPLQPGEIP 244
                     |.|..|.:.|
Mouse   462 ALQVQLAMSPSPPGPQDFP 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 20/69 (29%)
Tox2NP_001359507.1 HMG-box 272..337 CDD:238037 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.