DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Tox

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001364007.1 Gene:Tox / 252838 MGIID:2181659 Length:526 Species:Mus musculus


Alignment Length:380 Identity:77/380 - (20%)
Similarity:129/380 - (33%) Gaps:144/380 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SPVSLPIASQSMDTATIEDFDED--KPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPK 77
            ||.....|:.|..::..||..||  |...|:|:..        ||:|.:.|...:::......|:
Mouse   206 SPPGSKSATPSPSSSVHEDECEDASKINGGEKRPA--------SDMGKKPKTPKKKKKKDPNEPQ 262

  Fly    78 MPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPY---IEAAAKDKAIYQEQ 139
            .|::.|..|..|.:..::.:.|..|..|.::|:...|..|.||:|..|   .|||.|:   |.:|
Mouse   263 KPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKE---YLKQ 324

  Fly   140 LQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDVPLAK 204
            |..:                                          :|..|.:...||.|     
Mouse   325 LAAY------------------------------------------RASLVSKSYTDPVD----- 342

  Fly   205 VKRAQTP-----------------------------PPPTP------PAAP--VQPPPSSVPPAT 232
            ||.:|.|                             |..||      |:.|  :.|.|::..|.|
Mouse   343 VKTSQPPQLVNSKPSVFHGPSQAHSALYLSSHYHQQPGMTPQLTAMHPSLPRNIAPKPNNQMPVT 407

  Fly   233 ----------PAPRPLQPGEIPIYTNEFIEHNRS--------TENELRTLRKAKTDLEQQNAVLE 279
                      |.|..:.|   |::.:..::.::|        ::..::......:...||...|:
Mouse   408 VSIANMAVSPPPPLQISP---PLHQHLSMQQHQSLAMQQPLGSQLPMQVQTALHSPTMQQGFTLQ 469

  Fly   280 ---QHVDNTKAGYAKVMGEVTELMEENQRLETYLRALRQKLVAALGGISMPPLEP 331
               |.:.|..:..|:|   ||:.||       |:|:          |...||.:|
Mouse   470 PDYQTIINPTSTAAQV---VTQAME-------YVRS----------GCRNPPPQP 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 21/67 (31%)
ToxNP_001364007.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..264 16/65 (25%)
Nuclear localization signal. /evidence=ECO:0000255 237..256 5/26 (19%)
NHP6B <257..>360 CDD:227935 31/152 (20%)
HMG-box 261..>310 CDD:238037 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.