DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Tox3

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_766501.2 Gene:Tox3 / 244579 MGIID:3039593 Length:575 Species:Mus musculus


Alignment Length:238 Identity:55/238 - (23%)
Similarity:98/238 - (41%) Gaps:50/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SKTPDAVPESPVSLPIASQSMDTATIEDFDEDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRI 70
            |.|..:.|.|..:.|..|.|::.   ||.|:...|.|:|:        :..|.|.:.|...:::.
Mouse   195 SHTSPSPPASKSATPSPSSSINE---EDADDANRAIGEKR--------TAPDSGKKPKTPKKKKK 248

  Fly    71 NVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPY---IEAAAKD 132
            .....|:.|::.|..|..|.:..::.:.|..|..|.::|:...|..|.||:|..|   .|||.|:
Mouse   249 KDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKE 313

  Fly   133 KAIYQEQLQMFLKEHPEIVANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVK--RQSE 195
                      :||......|:.::||                      .|:..:|:.::  :|:.
Mouse   314 ----------YLKALAAYRASLVSKA----------------------AAESAEAQTIRSVQQTL 346

  Fly   196 DPDDVPLAKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRPL 238
            ...::..:.:.........|.||:| |..|.|:|.:. ||:||
Mouse   347 ASTNLTSSLLLNTSLSQHGTVPASP-QTLPQSLPRSI-APKPL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 19/67 (28%)
Tox3NP_766501.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..258 17/73 (23%)
HMG-box 254..319 CDD:238037 21/74 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.