DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Ubtf

DIOPT Version :10

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001391562.1 Gene:Ubtf / 21429 MGIID:98512 Length:789 Species:Mus musculus


Alignment Length:332 Identity:69/332 - (20%)
Similarity:127/332 - (38%) Gaps:100/332 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TATIEDFDE--DKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDR 90
            |..|.|..|  ..|.||||..|:|                        ..||.||..|.||..::
Mouse    86 TELILDAQEHVKNPYKGKKLKKHP------------------------DFPKKPLTPYFRFFMEK 126

  Fly    91 REELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANEL 155
            |.:..:..|:.:.|:.|:|:.:::.:|||::|:.||:...::|..::..|..|.::||:::.|  
Mouse   127 RAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQN-- 189

  Fly   156 AKAKKATKLDGSPKEKTPKG----------------------ESALGKA------KKT-----KA 187
                 |.|.|...|.|||:.                      :.:|||.      ||.     ||
Mouse   190 -----AKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKA 249

  Fly   188 KPVKRQSED---------------PDDVPLAKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRP 237
            ...:::.|:               .:.:..:.:.:|:..........|.:|||:|          
Mouse   250 LEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNS---------- 304

  Fly   238 LQPGEIPIYTNEFIEHNR---STENELRTLRKAKTDLEQQNAVLEQHVDNTKAGY-AKVMGEVTE 298
                 ..:|..|.:.:.:   |||..:...::.|...:::.....:..|..|..| .:::..:..
Mouse   305 -----YSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLES 364

  Fly   299 LMEENQR 305
            |.||.|:
Mouse   365 LPEEEQQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMG-box_HMG20 75..154 CDD:438796 23/78 (29%)
UbtfNP_001391562.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HMG-box_UBF1_rpt1-like 109..185 CDD:438814 23/99 (23%)
HMG-box_UBF1_rpt2 196..270 CDD:438815 12/73 (16%)
HMG-box_UBF1_rpt3 297..379 CDD:438816 18/90 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..411 1/2 (50%)
HMG-box_UBF1_rpt4 405..470 CDD:438817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 456..487
HMG_box_5 479..562 CDD:434287
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 546..576
HMG-box_UBF1_rpt6-like 565..650 CDD:438819
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.