DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and hmg-6

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_493451.2 Gene:hmg-6 / 185946 WormBaseID:WBGene00009827 Length:128 Species:Caenorhabditis elegans


Alignment Length:83 Identity:18/83 - (21%)
Similarity:39/83 - (46%) Gaps:8/83 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWH 115
            |.:|:|   .:::::.|::..:...     :.|..|..:|:...:|..|..|..:.::.|..:|.
 Worm    32 GGNSNS---RQIQEMDQKKKKIRST-----SAYALFFRERQSLEKRAAPYATFGQISQKIARQWD 88

  Fly   116 QLPEERKLPYIEAAAKDK 133
            .|.||.|..|.:...|::
 Worm    89 SLTEEEKKAYKQRCEKNR 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 14/58 (24%)
hmg-6NP_493451.2 HMG-box 51..107 CDD:238037 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.