DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and B0238.11

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_504410.1 Gene:B0238.11 / 178915 WormBaseID:WBGene00015075 Length:317 Species:Caenorhabditis elegans


Alignment Length:259 Identity:52/259 - (20%)
Similarity:86/259 - (33%) Gaps:89/259 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EPTSKTPDAVPESPVSLPIASQSMDTATIEDFDEDKPA------------------------KGK 43
            ||....|  :.||.:...:..|| :|:|:.:. |:|.|                        |..
 Worm    71 EPDVMRP--LIESFLEFLVQRQS-ETSTVHNM-ENKVAEWAETRRDDNIDAGLFVLDFRKYLKSA 131

  Fly    44 KKAKNPKGRHSDSDIGS---------ELKKLAQR------------RINVAGAPKMPLNGYVRFM 87
            .|.||.:...|.:.|.:         |.|.:..|            :|.:.|....|:....:.|
 Worm   132 VKFKNLQMNDSCAAISTYLNSEKSLVEYKSMPDRPPTKIQLYIKKHQIMLKGIGGEPMKNAYKAM 196

  Fly    88 NDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVA 152
            |...|.                 .:|..:|..|..|.||           .|||.||..||.:..
 Worm   197 NADTEG-----------------AKELDELLREASLQYI-----------PQLQEFLDTHPNLTE 233

  Fly   153 NE----------LAKAKKATKLDGSPKEKTPK--GESALGKAKKTKAKPVKRQSEDPDDVPLAK 204
            .:          |.|...:.::..:||:::.|  .|:|.....:||....:..|::..::.|.|
 Worm   234 EQKRSIVNKMKMLNKKYNSKEISSTPKKRSSKKDPETAFSLFCRTKNDKYRDLSDEEREIKLQK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 11/64 (17%)
B0238.11NP_504410.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.