Sequence 1: | NP_611553.1 | Gene: | Hmg-2 / 37407 | FlyBaseID: | FBgn0026582 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001380090.1 | Gene: | hmg-1.2 / 175890 | WormBaseID: | WBGene00001972 | Length: | 235 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 41/197 - (20%) |
---|---|---|---|
Similarity: | 73/197 - (37%) | Gaps: | 56/197 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 PTSKTPDAVPESPVSLPIASQSMDTATIEDFDEDKPAKGK--------------KKAKNPKGRHS 54
Fly 55 DSDIGSELK---------------KLAQR-------RINVAG------------------APKMP 79
Fly 80 LNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFL 144
Fly 145 KE 146 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hmg-2 | NP_611553.1 | HMGB-UBF_HMG-box | 76..141 | CDD:238686 | 17/64 (27%) |
hmg-1.2 | NP_001380090.1 | HMGB-UBF_HMG-box | 50..112 | CDD:238686 | 7/61 (11%) |
HMGB-UBF_HMG-box | 135..200 | CDD:238686 | 17/64 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3288 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |