DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and hmg-1.2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001380090.1 Gene:hmg-1.2 / 175890 WormBaseID:WBGene00001972 Length:235 Species:Caenorhabditis elegans


Alignment Length:197 Identity:41/197 - (20%)
Similarity:73/197 - (37%) Gaps:56/197 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTSKTPDAVPESPVSLPIASQSMDTATIEDFDEDKPAKGK--------------KKAKNPKGRHS 54
            |:|.:| .:.:|....|..|.:|..||..|..: .|.:||              .|.|.|.....
 Worm    11 PSSSSP-TLYQSHQLQPNPSATMYQATPRDMGK-PPVRGKTSPYGFFVKMCYEEHKKKYPNENVQ 73

  Fly    55 DSDIGSELK---------------KLAQR-------RINVAG------------------APKMP 79
            .::|..:..               :|||:       .::||.                  |||..
 Worm    74 VTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAKKDPHAPKRA 138

  Fly    80 LNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFL 144
            |:.:..:..|:|.|::...|.....:..:.:|:.|..:|:|.|..|.:.|..||..|.::::.:.
 Worm   139 LSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYK 203

  Fly   145 KE 146
            .|
 Worm   204 AE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 17/64 (27%)
hmg-1.2NP_001380090.1 HMGB-UBF_HMG-box 50..112 CDD:238686 7/61 (11%)
HMGB-UBF_HMG-box 135..200 CDD:238686 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.