DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and Hmg20b

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006513311.1 Gene:Hmg20b / 15353 MGIID:1341190 Length:415 Species:Mus musculus


Alignment Length:345 Identity:92/345 - (26%)
Similarity:149/345 - (43%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQ 100
            |::|.   ||...|||:              :|:..:...||.|:.|||||:|:|||::|...|.
Mouse    47 EEEPV---KKRGWPKGK--------------KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPD 94

  Fly   101 RTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKKATKLD 165
            ....|.|:::|.||.:|....|..|::.|.|:|..|.::|..:.:.....|..|..:..|..|.|
Mouse    95 LPFPEITKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKIQENKIKKED 159

  Fly   166 GSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDVPLAKVKRAQTPPPPTPPAAPVQPPPSSVPP 230
            .|         |.|........|.|     |.|.                               
Mouse   160 SS---------SGLMNTLLNGHKGV-----DCDG------------------------------- 179

  Fly   231 ATPAPRPLQPGEIPIYTNEFIEHNRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYAKVMGE 295
                   ....::||:|.||::.|::.|.|||.|||.....|:|||||::|..:..:...::..|
Mouse   180 -------FSTFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQE 237

  Fly   296 VTELMEENQ--RLETYLRALRQKLVAALGGISMPPLEPSGPSVGNIDKYIRHLAGLVTQ-PSNVT 357
            :.  :||.:  .|:..|:|:||.|.|:...:.:|....: |::|.:|.|:..|.|.:.: |:...
Mouse   238 LA--LEERRTLALQQQLQAVRQALTASFASLPVPGTGET-PTLGTLDFYMARLHGAIERDPAQHE 299

  Fly   358 LIKAR--EAL-RKVDTSSLL 374
            .:.||  |.| |:...:.||
Mouse   300 RLIARVKEILARRAPVTDLL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 26/64 (41%)
Hmg20bXP_006513311.1 HMGB-UBF_HMG-box 70..134 CDD:238686 26/63 (41%)
OmpH 190..>254 CDD:214922 22/65 (34%)
FAM222A <314..>400 CDD:373691 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8844
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4647
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45555
OrthoDB 1 1.010 - - D1458939at2759
OrthoFinder 1 1.000 - - FOG0003510
OrthoInspector 1 1.000 - - otm43265
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X2882
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.970

Return to query results.
Submit another query.