DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and tox3

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001121484.1 Gene:tox3 / 100158584 XenbaseID:XB-GENE-5887160 Length:580 Species:Xenopus tropicalis


Alignment Length:390 Identity:76/390 - (19%)
Similarity:151/390 - (38%) Gaps:68/390 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSKTPDAVPESPVSLPIASQSMDTATIEDFDEDKPAKGKKKAKNPKGRHSDSDIGSELKKLAQRR 69
            ||.:|   |.|..:.|..|.|::.   ||.||.....|:|:|.        .|.|.:.|...:::
 Frog   200 TSPSP---PASKSATPSPSSSVND---EDVDETNRTIGEKRAA--------PDSGKKPKTPKKKK 250

  Fly    70 INVAGAPKMPLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKA 134
            ......|:.|::.|..|..|.:..::.:.|..|..|.::|:...|..|.||:|..|   ..|.:|
 Frog   251 KKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVY---KRKTEA 312

  Fly   135 IYQEQLQMFLKEHPEIVANELAKAKKA------------TKLDGSPKEKTPKGE-SALGKAKKTK 186
            ..:|.|:........:|:...|::.:|            |.|..:....|...: :|:..|.:..
 Frog   313 AKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLSSTLLLNTSLSQHAAVSVASQNL 377

  Fly   187 AKPVKRQSED-------PDDVPLAKVKRAQTPPP--PTPPAAPVQPPPSSVPPATPAPRPLQPGE 242
            .:.:.|....       |.:..:..|..|...|.  .||..:.:..|..:.||::.....||..:
 Frog   378 QQSIPRAIAPKPLTMRLPSNQIVTSVTIAPNMPSNIGTPLMSSMGAPMVATPPSSQVSPSLQSQQ 442

  Fly   243 IPIYTNEFIEHNRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYAKVMGEVTELMEENQRLE 307
            ..|        .:..:.:|..:::.:....|.:..::|.:...:  :...|.:..:..::.|:|:
 Frog   443 HQI--------QQLQQQQLHQMQQQQLHQHQMHQQIQQQMQQQQ--FQHHMQQQLQQQKQQQQLQ 497

  Fly   308 ---------TYLRALRQKLVAAL---GGISMPPLEPSGPSVG---NIDKYIRHLAGLVTQPSNVT 357
                     .:|:.::|:.:..:   ..:|.....|:|...|   .|...|.|    ::.||.|:
 Frog   498 QQMQQQLQHIHLQHMQQQQMQHIQHQSQLSPQQQSPAGSQSGVPAQIASPIPH----ISSPSPVS 558

  Fly   358  357
             Frog   559  558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 18/64 (28%)
tox3NP_001121484.1 HMG-box 257..322 CDD:238037 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.