DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg-2 and tox2

DIOPT Version :9

Sequence 1:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_004918576.1 Gene:tox2 / 100124824 XenbaseID:XB-GENE-982431 Length:507 Species:Xenopus tropicalis


Alignment Length:305 Identity:66/305 - (21%)
Similarity:114/305 - (37%) Gaps:80/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SPVSLPIASQSMDTATIEDFDEDK-PAKGKKKAKNPKGRHSDSDIGSELKKLAQRRINVAGAPKM 78
            ||.....|:.|..::|.|:..|.. ...|:|:..|        |:|.:.|...:::......|:.
 Frog   192 SPPGSKSATPSPSSSTQEEETESHYKGAGEKRPSN--------DLGKKPKNQKKKKKKDPNEPQK 248

  Fly    79 PLNGYVRFMNDRREELRREQPQRTALEHTRIIGEEWHQLPEERKLPY---IEAAAKD--KAIYQE 138
            |::.|..|..|.:..::.:.|..|..:.::|:...|..|.||:|..|   .|||.|:  ||:...
 Frog   249 PVSAYALFFRDTQAAIKGQNPNATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAY 313

  Fly   139 QLQMFLKEHPEIVANELAKAKKATKL--------DGSPKEKTP----------------KGESAL 179
            :..:..|.:.|....:.::|.:|:|:        :..|:..:|                :|....
 Frog   314 RASLVSKSYSEQGDTKNSQANQASKMILPKQSMYNLPPQSSSPYPGLASFLSPTDLQSYRGHPHS 378

  Fly   180 GKAKKTKAK------------------PVKRQSEDPDDVPL-AKVKRAQTPPPP-TPPAAPVQPP 224
            |.::...||                  |:.:....|....| ..:...|.|.|| ..|:..:|.|
 Frog   379 GLSRTLNAKSMLPSISASPPPPFQISPPLHQHLRHPPSSLLNQSLNMQQVPQPPILSPSMALQSP 443

  Fly   225 PSSVP------------------PATP-APRPLQPGEIPIYTNEF 250
            .||.|                  |.:| :..|  ||. |.:.|||
 Frog   444 MSSSPTGQQDFSHLPSEFQSSVGPRSPTSSNP--PGN-PEWDNEF 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 20/69 (29%)
tox2XP_004918576.1 HMG-box 246..311 CDD:238037 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.