DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9406 and CAM2

DIOPT Version :10

Sequence 1:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001189724.1 Gene:CAM2 / 818710 AraportID:AT2G41110 Length:161 Species:Arabidopsis thaliana


Alignment Length:168 Identity:47/168 - (27%)
Similarity:76/168 - (45%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNNELEEKISEAFCIFDTHGDKY------------IDSRNVGNVLRFLGCAPTEKEVEDVIKATD 59
            |.::...:..|||.:||..||..            |.::.:|.|:|.||..|||.|::|:|...|
plant     5 LTDDQISEFKEAFSLFDKDGDGMLHPPFPSIIVGCITTKELGTVMRSLGQNPTEAELQDMINEVD 69

  Fly    60 -----SVDYPGEAHLVKFMEHVSKLLMDRQMEPA-SSEKLLEAFETLDPENKKYLTKEYFGKLMA 118
                 ::|:|      :|:.     ||.|:|:.. |.|:|.|||...|.:...:::......:|.
plant    70 ADGNGTIDFP------EFLN-----LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMT 123

  Fly   119 EEGEPFSAEELDAMWPVAIDPITGHIPYTFYINQLRHK 156
            ..||..:.||:|.|...|.....|.|.|..::..:..|
plant   124 NLGEKLTDEEVDEMIKEADVDGDGQINYEEFVKVMMAK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 46/166 (28%)
CAM2NP_001189724.1 PTZ00184 1..161 CDD:185504 46/166 (28%)

Return to query results.
Submit another query.