DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9406 and MYL1

DIOPT Version :10

Sequence 1:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_524144.1 Gene:MYL1 / 4632 HGNCID:7582 Length:194 Species:Homo sapiens


Alignment Length:152 Identity:38/152 - (25%)
Similarity:67/152 - (44%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VGVTLNNELEEKISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKEVEDVIKATDSVDYPGEA 67
            :.:..:.|.:::..|||.:||..||..|....||:|||.||..||..||..|:....:.:.  .|
Human    43 IKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEEL--NA 105

  Fly    68 HLVKFMEHVSKL-LMDRQMEPASSEKLLEAFETLDPENKKYLTKEYFGKLMAEEGEPFSAEELDA 131
            ..::|.:.:..: .:....:.|:.|..:|.....|.|....:.......::|..||....||::|
Human   106 KKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEA 170

  Fly   132 MWPVAIDPITGHIPYTFYINQL 153
            :.....|. .|.|.|..::..:
Human   171 LMAGQEDS-NGCINYEAFVKHI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 38/148 (26%)
MYL1NP_524144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
PTZ00184 45..193 CDD:185504 38/150 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.