DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9406 and Cam

DIOPT Version :9

Sequence 1:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster


Alignment Length:153 Identity:44/153 - (28%)
Similarity:76/153 - (49%) Gaps:18/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EEKIS---EAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKEVEDVIKATD-----SVDYPGEAH 68
            ||:|:   |||.:||..||..|.::.:|.|:|.||..|||.|::|:|...|     ::|:|    
  Fly     7 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP---- 67

  Fly    69 LVKFMEHVSKLLMDRQMEPASSEKLLEAFETLDPENKKYLTKEYFGKLMAEEGEPFSAEELDAMW 133
              :|:..:::.:.|..    |.|::.|||...|.:...:::......:|...||..:.||:|.|.
  Fly    68 --EFLTMMARKMKDTD----SEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 126

  Fly   134 PVAIDPITGHIPYTFYINQLRHK 156
            ..|.....|.:.|..::..:..|
  Fly   127 READIDGDGQVNYEEFVTMMTSK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 43/151 (28%)
EFh 14..>59 CDD:298682 20/47 (43%)
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 43/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443709
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.