DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9406 and B0563.7

DIOPT Version :10

Sequence 1:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_509544.1 Gene:B0563.7 / 182041 WormBaseID:WBGene00015264 Length:229 Species:Caenorhabditis elegans


Alignment Length:165 Identity:42/165 - (25%)
Similarity:72/165 - (43%) Gaps:29/165 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELEEKISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKEVEDVIKATDSVDYPGEAHLVKFME 74
            ||:| ..:.|.:|||.|...|.:..:...:..:|....:.|:::|||..|: |..||   :.|.|
 Worm    49 ELKE-YRQLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEIDNVIKEVDA-DGNGE---IDFEE 108

  Fly    75 HVSKLLMDRQMEPASSEKLL-EAFETLDPENKKYLTKEYFGKLMAEEGEPFSAE-------ELDA 131
            ..:.:...:.:..:::|:|: |.||..|.:....:|:..| |.:|:|...|..|       |||.
 Worm   109 FCACMKKSQNIVKSTNEELIRECFEIFDQDRNGIITENEF-KYIAKEFGDFDDELAEKVFRELDV 172

  Fly   132 MWPVAIDPITGH--------IPYTFYINQLRHKPD 158
                   ...||        |...:.:|..:|..|
 Worm   173 -------SANGHLSADQFATIVEDYLLNDPKHDID 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 40/161 (25%)
B0563.7NP_509544.1 PTZ00184 46..183 CDD:185504 38/146 (26%)

Return to query results.
Submit another query.