DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and BAG3

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_004272.2 Gene:BAG3 / 9531 HGNCID:939 Length:575 Species:Homo sapiens


Alignment Length:158 Identity:39/158 - (24%)
Similarity:58/158 - (36%) Gaps:28/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 PLPPKWETAY-TERGELYFIDHNTGTSHWLDPRLSKYQKKSLEDCCE------DELPYGWE--KI 348
            ||||.||... .:.|..:|:|||:.|:.|.|||:.....|.......      ..||...|  .:
Human    21 PLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPSREGSRLPPAREGHPV 85

  Fly   349 EDSMYGMYFIDHV------NRRTQ----YENPVL-----EAKRRAAEQSQQQQQMQQQQQQMQEQ 398
            ...:...|....|      ||:..    |..|.:     ||...|.::||...:...:..|..:|
Human    86 YPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRGMPETTQPDKQ 150

  Fly   399 RSKTPTALSETMPTEAAEAHEQEEDESP 426
            ..:...|.:...|.    :|..|..:||
Human   151 CGQVAAAAAAQPPA----SHGPERSQSP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 12/29 (41%)
WW 342..372 CDD:238122 8/41 (20%)
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
BAG3NP_004272.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 20/70 (29%)
WW 21..53 CDD:197736 14/31 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..200 13/56 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..421
BAG 421..498 CDD:214591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.