DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Magi and Herc3

DIOPT Version :9

Sequence 1:	NP_001286661.1	Gene:	Magi / 37403	FlyBaseID:	FBgn0034590	Length:	1202	Species:	Drosophila melanogaster
Sequence 2:	NP_001348895.1	Gene:	Herc3 / 73998	MGIID:	1921248	Length:	1050	Species:	Mus musculus

Alignment Length:	97	Identity:	25/97 - (25%)
Similarity:	38/97 - (39%)	Gaps:	29/97 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   766 KPLQLQTQ--GKSNSSLQELDDI-----PYMDPYPKISRLSERLAEVTLQ----------GDANG 813
            :|.:|:..  |.||...:||::.     .|...:|.:....|...|..|:          |....
Mouse   926 QPAELRAMMVGNSNYDWEELEETAVYRGDYSSTHPTVKLFWETFHEFPLEKKKKFLLFLTGSDRI 990

  Fly   814 GIYGMPPSMQPL---------PLPLAHHESCY 836
            .|||| .|:|.:         .||:||  :||
Mouse   991 PIYGM-ASLQIIIQSTATGEEYLPVAH--TCY 1019

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Magi	NP_001286661.1	WW	294..323	CDD:278809
		WW	342..372	CDD:238122
		PDZ	443..534	CDD:214570
		DegQ	<455..534	CDD:223343
		PDZ_signaling	606..668	CDD:238492
		PDZ	925..1011	CDD:214570
		PDZ_signaling	1029..1110	CDD:238492
Herc3	NP_001348895.1	ATS1	2..331	CDD:227511
		RCC1	313..377	CDD:366085
		HECTc	702..1048	CDD:238033	25/97 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900