DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Magi and Herc6

DIOPT Version :9

Sequence 1:	NP_001286661.1	Gene:	Magi / 37403	FlyBaseID:	FBgn0034590	Length:	1202	Species:	Drosophila melanogaster
Sequence 2:	NP_080268.1	Gene:	Herc6 / 67138	MGIID:	1914388	Length:	1003	Species:	Mus musculus

Alignment Length:	138	Identity:	38/138 - (27%)
Similarity:	54/138 - (39%)	Gaps:	34/138 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   240 PPNSILKGSKENLLQNTYYN-GETGDSSLGSECGVGDVQ--------------HQNHESHDDP-- 287
            ||..|||..:.:|:::|... .:..|..|..:..||.:.              |...|...||
Mouse   655 PPYLILKVRRSHLVEDTLRQLRQVEDFDLRKQLSVGFINEIRPEAGGVSSEFFHCIFEEMTDPKY 719

  Fly   288 --------GDGLG-PLPPKWE-TAYTERGELYFID-HNTGTSHWLDPRLSKY-----QKKSLEDC 336
                    |..:. |:.||:| ::|...|.|..:. ||....:...| |:.|     ||.||||.
Mouse   720 EMFIYPEKGSSMWFPVNPKFEKSSYFLFGILCGLSLHNLKVINLPFP-LALYKKLLNQKPSLEDL 783

  Fly   337 CEDELPYG 344
            .|..||.|
Mouse   784 KELSLPLG 791

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Magi	NP_001286661.1	WW	294..323	CDD:278809	8/30 (27%)
		WW	342..372	CDD:238122	2/3 (67%)
		PDZ	443..534	CDD:214570
		DegQ	<455..534	CDD:223343
		PDZ_signaling	606..668	CDD:238492
		PDZ	925..1011	CDD:214570
		PDZ_signaling	1029..1110	CDD:238492
Herc6	NP_080268.1	RCC1 1	40..91
		RCC1	40..89	CDD:278826
		RCC1 2	92..144
		RCC1	92..142	CDD:278826
		RCC1	145..195	CDD:278826
		RCC1 3	146..197
		RCC1_2	183..211	CDD:290274
		RCC1 4	199..252
		RCC1_2	237..266	CDD:290274
		RCC1 5	253..303
		RCC1	253..300	CDD:278826
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	261..281
		chaperonin_like	<570..>652	CDD:295468
		HECTc	658..999	CDD:238033	36/135 (27%)
		HECTc	682..999	CDD:214523	30/111 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900