DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and wwp2

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:XP_005163228.1 Gene:wwp2 / 564527 ZFINID:ZDB-GENE-000607-82 Length:867 Species:Danio rerio


Alignment Length:431 Identity:94/431 - (21%)
Similarity:144/431 - (33%) Gaps:117/431 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SLANGS--SRKFNCSRDNVDDGGDAGEMAAAS---QTLSSAGTDVVGNGSGHGNGTVTGNGEKSG 161
            ||.|||  |.|.:.||.::.........:.:|   ::|..:.....|:......|....||:.:|
Zfish   153 SLPNGSAASDKIHSSRSSLHRAHSEETPSTSSPRGRSLGQSSRGSCGDSPAEIQGAALTNGDVNG 217

  Fly   162 GLAPPGGHHLRPPPPPALKKSASAVIGNSASREDVASLSGTSSLNSQMSVHNQFISGLPSN-GIG 225
            .||.....|           ::...:.|.:|     :..|.::.|...|.|  .....||: .:.
Zfish   218 ALAETTSRH-----------NSKTTVNNLSS-----AGKGETAANGLESAH--LTCPAPSSPSLS 264

  Fly   226 SNGVHGGAATGRGGPPNSILKGSKENLLQNTYYNGETGDSSLGSECGVGDVQHQNHESHDDPGDG 290
            ||...|........||.|            |..:..|.|:             ||.::       
Zfish   265 SNPPDGTVPPPAAEPPAS------------TEQSDTTSDT-------------QNTDA------- 297

  Fly   291 LGPLPPKWETAYTERGELYFIDHNTGTSHWLDPRLSKYQKKSLEDCCEDELPYGWEKIEDSMYGM 355
               ||..||......|.:|::||||.|:.|                 |..||.||||..|.....
Zfish   298 ---LPAGWEQRILPHGRVYYVDHNTKTTTW-----------------ERPLPPGWEKRVDQRGRF 342

  Fly   356 YFIDHVNRRTQYENPVLEAKRRAAEQSQQQQQMQQQQQQMQEQRSKTPT-ALSETMPTEA-AEAH 418
            |::||..|.|.::.|..|:.|...:...|:.|:|...||..::....|: |:.|..|..| ....
Zfish   343 YYVDHNTRTTTWQRPTAESVRNYEQWQSQRSQLQGAMQQFNQRYLYQPSGAVVENDPLGALPPGW 407

  Fly   419 EQEEDESPMKLPYKFTRNPAELQGQRINTTLLKSSRGLGFTIVGSDGSAGGDVEEFLQIKTVVPN 483
            |:.:|...:   |....|....|.:                    |....|.::|       .|.
Zfish   408 EKRQDNGRV---YYVNHNTRTTQWE--------------------DPRTQGMIQE-------PPL 442

  Fly   484 GPAWLDGQLQTGDVLVYVNDTCVLGYTHHDMVNIFQSILPG 524
            .|.|  ....|.:.:.|..|       |:.....|:...||
Zfish   443 PPGW--EMKYTAEGVRYFVD-------HNSRTTTFKDPRPG 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 12/28 (43%)
WW 342..372 CDD:238122 12/29 (41%)
PDZ 443..534 CDD:214570 13/82 (16%)
DegQ <455..534 CDD:223343 13/70 (19%)
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
wwp2XP_005163228.1 C2_E3_ubiquitin_ligase 17..145 CDD:175988
WW 298..327 CDD:197736 13/45 (29%)
WW 328..357 CDD:278809 12/28 (43%)
WW 403..431 CDD:278809 5/50 (10%)
WW 441..473 CDD:197736 8/40 (20%)
HECTc 513..865 CDD:238033
HECTc 536..864 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.