DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Magi and ube3b

DIOPT Version :9

Sequence 1:	NP_001286661.1	Gene:	Magi / 37403	FlyBaseID:	FBgn0034590	Length:	1202	Species:	Drosophila melanogaster
Sequence 2:	NP_001108154.1	Gene:	ube3b / 556864	ZFINID:	ZDB-GENE-060526-231	Length:	1069	Species:	Danio rerio

Alignment Length:	115	Identity:	28/115 - (24%)
Similarity:	44/115 - (38%)	Gaps:	38/115 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly   892 VGFANLDPPQQMQHSPSWRNGALLDVSEDADQCELTEVTLERQALGFGFRIVGGTEEGSQVTVGH 956
            :|||.|.||..::         .::||:|.|    |..||.....||             .|:..
Zfish   986 LGFAYLKPPFSIR---------CVEVSDDQD----TGDTLGSVLRGF-------------FTIRK 1024

  Fly   957 IVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTM 1006
            ..|||      |:.|     |....|:|...::...|::.:. ||..::|
Zfish  1025 KEPGG------RLPT-----SSTCFNLLKLPNYSKKSILRDK-LRYAISM 1062

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Magi	NP_001286661.1	WW	294..323	CDD:278809
		WW	342..372	CDD:238122
		PDZ	443..534	CDD:214570
		DegQ	<455..534	CDD:223343
		PDZ_signaling	606..668	CDD:238492
		PDZ	925..1011	CDD:214570	18/82 (22%)
		PDZ_signaling	1029..1110	CDD:238492
ube3b	NP_001108154.1	IQ	28..50	CDD:197470
		HECTc	683..1067	CDD:238033	28/115 (24%)
		HECTc	708..1066	CDD:214523	28/115 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900