DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and HERC6

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:331 Identity:58/331 - (17%)
Similarity:112/331 - (33%) Gaps:102/331 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   589 SGFILMKKPEIYTFSIMKGSMGFGFTIADSACG------QIVKKI------LDRNCCTQLMEGDV 641
            |.|:|:  ||.......|.........|.:.|.      |::||.      ...|...|:::..:
Human   492 SVFLLL--PECPVMHDSKNWKNLVVPFAKAVCEMSKQSLQVLKKCWAFLQESSLNPLIQMLKAAI 554

  Fly   642 LLEINGLNVRNKPHFYVVELL---KECSQTTPTAVKIQRTPPDPPANNTLAQLNQVGNVAKL--- 700
            :.::.......:.|..|..||   ||..:......::    |:    ||. .:|::.|:...   
Human   555 ISQLLHQTKTEQDHCNVKALLGMMKELHKVNKANCRL----PE----NTF-NINELSNLLNFYID 610

  Fly   701 --RKNFVGSGLFRSKTPTADLYSTQVKEVLPMRPKTPLVDTRRSRVQIQSPNNEVDDEGDGAAAA 763
              |:.|..:.|..::||:..::|           ..|.:....|::::...::.:..:     .:
Human   611 RGRQLFRDNHLIPAETPSPVIFS-----------DFPFIFNSLSKIKLLQADSHIKMQ-----MS 659

  Fly   764 ERKPLQLQTQGKSNSSLQELDDIPYMDPYPKI------SRLSERLAEVTLQGDA----------- 811
            |:|...|..:    :.||:.|:.|   |.|:.      |||.:.......|.:|           
Human   660 EKKAYMLMHE----TILQKKDEFP---PSPRFILRVRRSRLVKDALRQLSQAEATDFCKVLVVEF 717

  Fly   812 -------NGGI----------------YGMPPSMQPLPLPLAHHESCYCYDCQAQRYRPGYFVQA 853
                   :||:                |||  .|.|      ...||..:..:.:..:..||:..
Human   718 INEICPESGGVSSEFFHCMFEEMTKPEYGM--FMYP------EMGSCMWFPAKPKPEKKRYFLFG 774

  Fly   854 QQAAMS 859
            ....:|
Human   775 MLCGLS 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809
WW 342..372 CDD:238122
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492 14/76 (18%)
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274
RCC1_2 89..118 CDD:290274
RCC1 105..155 CDD:278826
RCC1 158..208 CDD:278826
RCC1 215..263 CDD:278826
RCC1_2 250..279 CDD:290274
RCC1 266..313 CDD:278826
HECTc 684..1026 CDD:238033 17/105 (16%)
HECTc 711..1026 CDD:214523 12/78 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.