Sequence 1: | NP_001286661.1 | Gene: | Magi / 37403 | FlyBaseID: | FBgn0034590 | Length: | 1202 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004931.1 | Gene: | sav1 / 448321 | XenbaseID: | XB-GENE-945676 | Length: | 389 | Species: | Xenopus tropicalis |
Alignment Length: | 249 | Identity: | 62/249 - (24%) |
---|---|---|---|
Similarity: | 102/249 - (40%) | Gaps: | 71/249 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 235 TGRGGPPNSILKG----------SKENLLQNTYYNGETGDSSLGSECG-----------VGDVQH 278
Fly 279 QNHESHDDPGD--------------GLG------------------PLPPKWETAYTERGELYFI 311
Fly 312 DHNTGTSHWLDPRLSKYQKKSLEDCCEDELPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKR 376
Fly 377 RAAEQSQQQQQMQQQQQQMQEQRSKTPTALSETMPTEAAEAHE--QEEDESPMK 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Magi | NP_001286661.1 | WW | 294..323 | CDD:278809 | 16/28 (57%) |
WW | 342..372 | CDD:238122 | 13/29 (45%) | ||
PDZ | 443..534 | CDD:214570 | |||
DegQ | <455..534 | CDD:223343 | |||
PDZ_signaling | 606..668 | CDD:238492 | |||
PDZ | 925..1011 | CDD:214570 | |||
PDZ_signaling | 1029..1110 | CDD:238492 | |||
sav1 | NP_001004931.1 | WW | 205..235 | CDD:238122 | 16/38 (42%) |
WW | 240..269 | CDD:238122 | 12/28 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D284488at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |