DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and bag3

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_001003533.1 Gene:bag3 / 445139 ZFINID:ZDB-GENE-040801-40 Length:459 Species:Danio rerio


Alignment Length:271 Identity:58/271 - (21%)
Similarity:91/271 - (33%) Gaps:92/271 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 PLPPKWETAY-TERGELYFIDHNTGTSHWLDPRLSKYQKKSLEDCCEDELPYGWEK-----IEDS 351
            ||||.||... .:.|..:|:|||..|:.|.|||....:..|.......|.|....|     :...
Zfish     6 PLPPGWEIKIDPQTGWPFFVDHNNRTTTWNDPRHDTKKIFSNGPSMSPETPQDMHKTFINEMRQP 70

  Fly   352 MYGMYFID----HVN---RRTQYEN----------------------PVLEAKRRAAEQSQQQ-- 385
            |....:|.    |.|   |..||.:                      |....:.|:..|:..:  
Zfish    71 MLRQGYIPIPVCHENPEPRLQQYPSFSYIHPAVQQNLRTDGRTPSPTPAAHCRPRSPVQTPSEAC 135

  Fly   386 ------------QQMQQQQQQM----QEQRSKT---------------------PTALSETM-PT 412
                        .|.|...||:    |:.||..                     |:.||::. ||
Zfish   136 SSCSPTSHGPEGYQPQGTHQQISGLHQQPRSSNTGLRAGYIPIPVIHEGAGGVLPSQLSQSSHPT 200

  Fly   413 EAAEAHE-------QEEDESPMKLPYKFTRNP--AELQGQRINTTLLKSSRGLGFTIVGSDGSAG 468
            ......|       |....||:::|.: .::|  |::.|:|     .:..:.:|.|.:.|  ...
Zfish   201 REKIYREQVPIQIQQNRAASPIQVPLR-AQSPVMAQIMGER-----PQMQQHIGHTAIPS--KIE 257

  Fly   469 GDVEEFLQIKT 479
            ..|||.:::.|
Zfish   258 HPVEEIIRVPT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 12/29 (41%)
WW 342..372 CDD:238122 10/63 (16%)
PDZ 443..534 CDD:214570 8/37 (22%)
DegQ <455..534 CDD:223343 7/25 (28%)
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
bag3NP_001003533.1 WW 6..38 CDD:197736 14/31 (45%)
BAG 358..432 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.