DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and CG3356

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:264 Identity:56/264 - (21%)
Similarity:102/264 - (38%) Gaps:68/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 GQIVKKILDRNCCTQLMEGDVLLEINGL--NVRNKPHFYVVELLKECSQTTPTAVKIQRTPPD-- 681
            |:::..:.|    .:.:|..:||:::..  :||..| |.:.|:           :::.:|..|  
  Fly   551 GRLLPTLHD----VEFVENKLLLQVHSTINHVRLMP-FSIAEI-----------IQMSKTLKDIS 599

  Fly   682 --------PPANNTLAQLNQV-----GNVAKLR------KNFVGSGLF-RSKTPTADL------- 719
                    |...:.||...:|     .:..|||      .|.:...:| .::..|.||       
  Fly   600 MGLVELAFPETRSNLANYRKVLGHTEADDKKLRHQKQIWANLLNVVVFVLNQIHTRDLRLGFCPE 664

  Fly   720 -YSTQVKEVLPMRPKTPLVDTRRSRVQIQSPNNEVDD--EGDGAAAAERKPLQLQTQGKSNSSLQ 781
             :.|..:..||:...|.|..|..||::...|...:.|  ..|    .|..|.....|.:|.:.|:
  Fly   665 DHWTVTRLDLPLDRPTDLPLTHSSRLRGIRPFQPIRDFTRED----FENGPPMSTKQIRSITILR 725

  Fly   782 ELDDIPYMDPYPK-ISRLSERLA--EVTLQGDANGGIYGMPPSMQPLPLPLAHHESCYCYDCQAQ 843
            |   ||::.|:.| :|.|...:|  ::.:||:....:.|        |..|......:.|:....
  Fly   726 E---IPFVVPFNKRVSILQSLVAASKMRVQGNMQAFLQG--------PSVLITVRRSHLYEDAYD 779

  Fly   844 RYRP 847
            :.||
  Fly   780 KLRP 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809
WW 342..372 CDD:238122
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492 10/48 (21%)
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 3/18 (17%)
HECTc 788..1119 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.