DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and yki

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:269 Identity:60/269 - (22%)
Similarity:109/269 - (40%) Gaps:69/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PPPPALKKSASA------------VIGNSAS-------REDVASLS----GTSSLNSQMSVHNQF 215
            ||.|:..::.||            .|||.||       :..:|::.    ..|..:|::::|:..
  Fly   101 PPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSR 165

  Fly   216 ISGLPSNGIGSNGVHGGAATGRGGPPNSILKGSK--------ENLLQNTYYNGETGDSSLG---- 268
            ....|::...:..|...:.......||:.....:        ||..|. :.:|....|::.    
  Fly   166 ARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQE-FPSGAPASSAIDLDAM 229

  Fly   269 SECGVGDVQ------HQNHESHD--DP---GDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLD 322
            :.|...|:.      |:...|:|  .|   ...||.|||.||.|.|..|::|:::|.|.::.|.|
  Fly   230 NTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWED 294

  Fly   323 PRLSKYQKKSL--------EDCCE--------------DELPYGWEKIEDSMYGMYFIDHVNRRT 365
            ||:...|::.:        .|..:              ..||.|||:.......:|||:|::|.|
  Fly   295 PRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTT 359

  Fly   366 QYENPVLEA 374
            .:.:|.:::
  Fly   360 SWNDPRMQS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 12/28 (43%)
WW 342..372 CDD:238122 11/29 (38%)
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 31/108 (29%)
WW 266..295 CDD:395320 12/28 (43%)
WW 335..364 CDD:395320 11/28 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.