DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Herc6

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:XP_008761185.1 Gene:Herc6 / 362376 RGDID:1561739 Length:1027 Species:Rattus norvegicus


Alignment Length:219 Identity:53/219 - (24%)
Similarity:73/219 - (33%) Gaps:37/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 HPHPVAAATSFATFNGNSNLNSSLANGSSRKFNCSRDNVD--DGGDAGEMAAASQTLSSAGTDVV 142
            |.|.:|.:.....|:..||....|..|::.....|...|.  :|....::||..  ..|....::
  Rat   135 HYHSLALSEDGQVFSWGSNRQGQLGLGNNLCSQASPQKVKSLEGIPLAQVAAGG--THSFALSLM 197

  Fly   143 GNGSGHGNGTVTGNGEKSGGLAPPGG----HHLRPPPPPALKKSASAVIG-----NSASRED--V 196
            |...|.||       .:||.||..|.    ...:|....|||......|.     .|...||  |
  Rat   198 GTSFGWGN-------NRSGQLALSGNSAKEQIYKPHSIGALKTLNVVYISCGYEHTSVLTEDGQV 255

  Fly   197 ASLSGTSSLNSQMSVHNQFISGLPSNGIGSNGVHGGAATGRGGPPNSILKGSKENLLQNTYYNGE 261
            .:..|:||...|.|         |.:|.|...:    ..|.||..:.|..||...:.. .|..|:
  Rat   256 FTFGGSSSEQLQHS---------PRSGRGGPQL----IEGIGGHVSQIECGSYHTIAY-VYTTGQ 306

  Fly   262 TGDSSLGSECGVGDVQHQNHESHD 285
            ......|..| ..:..||.....|
  Rat   307 VVSLGRGPSC-TSNATHQEAACSD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809
WW 342..372 CDD:238122
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Herc6XP_008761185.1 RCC1 39..88 CDD:278826
RCC1 92..141 CDD:278826 2/5 (40%)
RCC1 144..194 CDD:278826 11/51 (22%)
RCC1_2 182..210 CDD:290274 8/36 (22%)
RCC1_2 236..265 CDD:290274 8/28 (29%)
RCC1 252..299 CDD:278826 16/59 (27%)
HECTc 682..1023 CDD:238033
HECTc 706..1023 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.