DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and smurf1

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_001001943.1 Gene:smurf1 / 321695 ZFINID:ZDB-GENE-040426-2744 Length:731 Species:Danio rerio


Alignment Length:382 Identity:89/382 - (23%)
Similarity:131/382 - (34%) Gaps:128/382 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SNLNSSLAN-GSSRKFNCSRDNVDDGGDAGEMAAASQTLSSAGTDVVGNGSG--HGNGTVTGNG- 157
            ||..|.|.: |..|...|..:..|.....|::..:.||     .|.:|:|..  ...|.|...| 
Zfish   102 SNAISRLKDTGYQRLDLCKLNPSDSDAVRGQIVVSLQT-----RDRIGSGGPVVDCRGLVENEGP 161

  Fly   158 --EKSGGLAPPGGHHLRP------PPPPALKKSASAVIGNSASREDVASLSGTSSLNSQMSVHNQ 214
              |.||    ||    ||      .|.|....:.:|..||..:.|         |.|.:..:..|
Zfish   162 VFEDSG----PG----RPLSCFMEEPMPYTDPTGAAGGGNCRALE---------SPNQEQRLQAQ 209

  Fly   215 FISGLPSNG---IGSNGVHGGAATGRGGPPNSILKGSKENLLQNTYYNGETGDSSLGSECGVGDV 276
            .|....|.|   ...|..||                                             
Zfish   210 RIRNQDSRGHTHTPQNRPHG--------------------------------------------- 229

  Fly   277 QHQNHESHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDPRLSKYQKKSLEDCCED-- 339
                |:|.|        ||..:|...|.:|::||:...||.|.|.|||:.: ...|:.  ||:  
Zfish   230 ----HQSPD--------LPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPR-DLNSVS--CEELG 279

  Fly   340 ELPYGWEKIEDSMYG-MYFIDHVNRRTQYENPVLEAKRRAAEQSQQQQQMQQQQQQMQEQRSKTP 403
            .||.|.| |..::.| :||:||.||.||:.:|.|             ..:..|..|::|.     
Zfish   280 PLPPGRE-IRSTVSGRIYFVDHNNRTTQFTDPRL-------------HHIMSQHSQVKES----- 325

  Fly   404 TALSETMPTEAAEAHEQEEDESPMKL------PYKFTRNPAELQGQRINTTLLKSSR 454
               |:.:|.:.....|:.:.|.|::.      ..|..|:...||..:.....::.||
Zfish   326 ---SQALPVQMEVGMEEGDGELPVRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 11/28 (39%)
WW 342..372 CDD:238122 14/30 (47%)
PDZ 443..534 CDD:214570 2/12 (17%)
DegQ <455..534 CDD:223343 89/382 (23%)
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
smurf1NP_001001943.1 C2_Smurf-like 14..138 CDD:176028 9/35 (26%)
WW 234..266 CDD:197736 14/39 (36%)
WW 280..312 CDD:197736 15/32 (47%)
HECTc 373..728 CDD:238033 2/7 (29%)
HECTc 397..728 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.