DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Magix

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_001014131.1 Gene:Magix / 317379 RGDID:1549729 Length:326 Species:Rattus norvegicus


Alignment Length:157 Identity:41/157 - (26%)
Similarity:68/157 - (43%) Gaps:21/157 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 SKTPTA-LSETMPTEAAEAHEQEEDESPMKLPYKFTRNPAELQGQ------RINTTLLKSSRGLG 457
            |:.|.| |.|..|     .|::.:.:.|...|....:|.|....:      |.:..|::...|.|
  Rat    80 SRLPHATLVEHRP-----QHQRSDTQGPRMEPLPVIQNKASYASRLPQATGRFSVELVRGPAGFG 139

  Fly   458 FTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVNDTCVLGYTHHDMVNIFQSIL 522
            .|:.|. .:..|:|.  |.:..::.:|||...|.||.||:::|:|.....|.||...|...::  
  Rat   140 LTLSGG-RNVSGNVP--LAVCGLLKDGPAQRCGHLQAGDLVLYINGQSTRGLTHAQAVEWIRT-- 199

  Fly   523 PGERAALEVCRGYPLPFDPNDPNTEVV 549
            .|.|..|.:.|    |.:.|...::.|
  Rat   200 GGPRLCLVLQR----PQEMNGSRSKEV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809
WW 342..372 CDD:238122
PDZ 443..534 CDD:214570 26/96 (27%)
DegQ <455..534 CDD:223343 24/78 (31%)
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
MagixNP_001014131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
PDZ_signaling 127..209 CDD:238492 25/86 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..267 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337267
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.