DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Arel1

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_001100214.1 Gene:Arel1 / 299197 RGDID:1307597 Length:823 Species:Rattus norvegicus


Alignment Length:605 Identity:119/605 - (19%)
Similarity:190/605 - (31%) Gaps:240/605 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 MQEQRSKTPTALSETMPTEAAEAHEQEEDESPMKL-----PYKFTRNPAELQ--GQRINTTLLKS 452
            |...:.:..|||.|......:|.|..|:.:.|.|:     |.:|:.....|:  ..|:.|  .:.
  Rat   319 MSSSQRRPSTALEEEEEDSPSECHTPEKVKKPKKVYCYVSPKQFSVKEFYLKIIPWRLYT--FRV 381

  Fly   453 SRGLGFTIVGSDGSAGGDVEEFLQIKTVVPNG---PAWL---DGQLQTGDVLVYVNDTCVLGYTH 511
            ..|..|:.:|.|     .|.:.|.:  ||.:|   |..|   :..:.....:..::.......|.
  Rat   382 CPGTKFSYLGPD-----PVHKLLTL--VVDDGIQPPVELSCKERNILAATFIRSLHKNIGGSETF 439

  Fly   512 HDMVNIFQSIL-------PGERAALEVCRGYPLP--------FDPND--PNTEVV---------- 549
            .|.||.||..|       |..:..|:|.|...|.        |..:|  .|.|||          
  Rat   440 QDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKATRNFSISDWSKNFEVVFQDEEALDWG 504

  Fly   550 ----------------TTMAVDGRESDKQR-------------RLNMDGNYNFLDLSGEGAKKTS 585
                            ||..:..|.||..:             ||.|   |.|            
  Rat   505 GPRREWFELICKALFDTTSQLFTRFSDNNQALVHPNPNRPAHLRLKM---YEF------------ 554

  Fly   586 GSGSGFILMKKPEIYTFSIMKGSMGFGFTIADSACGQIVKKILDRNCCTQLMEGDVLLEINGLNV 650
               :|.::.|       .:.:.|:|       .|..|:|:....|:         .|.:|.||.:
  Rat   555 ---AGRLVGK-------CLYESSLG-------GAYKQLVRARFTRS---------FLAQIIGLRM 593

  Fly   651 RNK------PHFY---VVELLKECSQTTPTAVKIQRTPPDPPANNTLAQL---------NQVGNV 697
            ..|      |.||   |..:|                      ||.::::         |:.|.:
  Rat   594 HYKYFETDDPEFYKSKVCFIL----------------------NNDMSEMELVFAEEKYNKSGQL 636

  Fly   698 AKLRKNFVGSGLFRSKTPTADLYST-------------QVKEVLP--MRPKTPLVDTRRSRVQIQ 747
            .|:.:...|.    ::||..:...|             ||||.:.  ::....||          
  Rat   637 DKIVELMTGG----AQTPVTNANKTFYLNLLAQYRLASQVKEEVEHFLKGLNELV---------- 687

  Fly   748 SPNN--EVDDEGDGAAAAERKPLQLQTQGKSNSSLQELDDIPYMDP-------------YPKISR 797
             |.|  .:.||.:         |:|...|..:.|:.:......:..             :..:|.
  Rat   688 -PENLLAIFDENE---------LELLMCGTGDISVSDFKAHAVVVGGSWHFREKVMRWFWTVVSS 742

  Fly   798 LSE----RLAEVTLQGDAN---GGIYGMPPSMQPL------PLPLAHHESCY---C---YDCQAQ 843
            |::    ||.:.| .|.:.   ||...:.||.|.:      .||.||  :|:   |   ||...:
  Rat   743 LTQEELARLLQFT-TGSSQLPPGGFAALCPSFQIIAAPTHSTLPTAH--TCFNQLCLPTYDSYEE 804

  Fly   844 RYRPGYFVQAQQAAMSGTTG 863
            .:|     ..|.|...|..|
  Rat   805 VHR-----MLQLAISEGCEG 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809
WW 342..372 CDD:238122
PDZ 443..534 CDD:214570 23/103 (22%)
DegQ <455..534 CDD:223343 21/91 (23%)
PDZ_signaling 606..668 CDD:238492 16/70 (23%)
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Arel1NP_001100214.1 Filamin 56..154 CDD:395505
HECTc 486..820 CDD:214523 80/429 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.