DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Sav1

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_001091050.1 Gene:Sav1 / 299116 RGDID:1307253 Length:387 Species:Rattus norvegicus


Alignment Length:233 Identity:65/233 - (27%)
Similarity:87/233 - (37%) Gaps:77/233 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 GSKENLLQNTYYNGETGDSS-----------------LGSEC----------------------- 271
            ||.::.|....:..|.|||.                 ||...                       
  Rat   113 GSSQSFLTEVNFAVENGDSGSRYFYSDNFFDGQRRRPLGDRAQEDYRYYEYNHDLFQRMPQNQGR 177

  Fly   272 ---GVGDV------QHQNHESHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDPRLSK 327
               |:|.|      ...||.|.|      .||||.|...:|.||..|:|||||.|:||..|    
  Rat   178 HTSGIGRVTATSLGNLTNHGSED------LPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHP---- 232

  Fly   328 YQKKSLEDCCEDELPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKRRAAEQSQQQQQMQQQQ 392
                 ||   .:.||.|||::|.|.:|.|::||.|:|.||.:|...:..|    ..|...:..|.
  Rat   233 -----LE---REGLPPGWERVESSEFGTYYVDHTNKRAQYRHPCAPSVPR----YDQPPPITYQP 285

  Fly   393 QQMQEQRSKTPTALSETMPTEAAEAHE--QEEDESPMK 428
            ||.:..:|    .|....|...||..:  |....:|:|
  Rat   286 QQTERNQS----LLVPANPYHTAEIPDWLQVYARAPVK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 16/28 (57%)
WW 342..372 CDD:238122 15/29 (52%)
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Sav1NP_001091050.1 WW 204..234 CDD:238122 16/38 (42%)
WW 239..268 CDD:238122 14/28 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.