Sequence 1: | NP_001286661.1 | Gene: | Magi / 37403 | FlyBaseID: | FBgn0034590 | Length: | 1202 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001091050.1 | Gene: | Sav1 / 299116 | RGDID: | 1307253 | Length: | 387 | Species: | Rattus norvegicus |
Alignment Length: | 233 | Identity: | 65/233 - (27%) |
---|---|---|---|
Similarity: | 87/233 - (37%) | Gaps: | 77/233 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 247 GSKENLLQNTYYNGETGDSS-----------------LGSEC----------------------- 271
Fly 272 ---GVGDV------QHQNHESHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDPRLSK 327
Fly 328 YQKKSLEDCCEDELPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKRRAAEQSQQQQQMQQQQ 392
Fly 393 QQMQEQRSKTPTALSETMPTEAAEAHE--QEEDESPMK 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Magi | NP_001286661.1 | WW | 294..323 | CDD:278809 | 16/28 (57%) |
WW | 342..372 | CDD:238122 | 15/29 (52%) | ||
PDZ | 443..534 | CDD:214570 | |||
DegQ | <455..534 | CDD:223343 | |||
PDZ_signaling | 606..668 | CDD:238492 | |||
PDZ | 925..1011 | CDD:214570 | |||
PDZ_signaling | 1029..1110 | CDD:238492 | |||
Sav1 | NP_001091050.1 | WW | 204..234 | CDD:238122 | 16/38 (42%) |
WW | 239..268 | CDD:238122 | 14/28 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D284488at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |